DPCstruct | MC4332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 253 ± 53 aa |
| Standard deviation of domain lengths | 52.68 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 97.12 |
| Assigned Pfam label(s) | PF02104- CL0261- PF08148- PF03194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I3GTK3 | 1-177 | MDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA… |
| A0A7J6N6J1 | 5-278 | RALLDQLMGRDRNVSAAEKVKIEEKKINWMTQTRYCPYFLVDFCPHDLFVNTKADMGPCNKEHCEYTKSRFEKWEDCAEKRAVVDKY… |
| A0A7R8XG80 | 5-305 | None |
| A0A5B7D9E5 | 102-280 | None |
| A0A4Y7J0I6 | 4-303 | None |
| A0A6I8NVD8 | 83-386 | None |
| A0A4U0W2A3 | 418-714 | None |
| A0A7J6PIT7 | 453-664 | None |
| A0A2A6CID1 | 74-358 | None |
| A0A0D6QY87 | 2-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.