DPCstruct | MC43319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 117 ± 17 aa |
| Standard deviation of domain lengths | 16.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3D6U3 | 4-112 | QRARVDKLQGILSMSVEMWLKILSLLSPQEVLQLARSSKDLRSIFMSRSSMPIWEAARRTVGCPSPISGFSEPAWANLLFMNTCHFC… |
| A0A2C5Y232 | 65-187 | KLPASTWQRILVLLPPKTLGALLSVSRVFNQWLDAESRFHAQTTPLLLLKPDAIWQASRRRFWPRMPAPLRASSELDMWRLCCSPCC… |
| A0A2H3EDC1 | 79-197 | None |
| A0A0H2S3G3 | 11-123 | None |
| A0A0H2SN77 | 23-150 | None |
| A0A4U0VWZ0 | 1-105 | None |
| A0A4V5NAV7 | 444-568 | None |
| A0A2N0Q160 | 104-224 | None |
| A0A146HPM1 | 389-506 | None |
| A0A0C9U0Q8 | 35-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.