DPCstruct | MC43312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 432 ± 44 aa |
| Standard deviation of domain lengths | 44.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 21.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3CQT2 | 40-513 | EMALVVRRLLHFHSRLPRGRSFIATPEFDSFEVTVAILSNGYRLSNGETECVSPGAFFIDIIHSSKLPPRCWYHLMMKSQDVLSPLD… |
| A0A2H3CKX2 | 1-479 | MELKIGCLLRFDPNGSWTRYNAFLDTTPSLYSFELTAAILSNGCTLRDKETLNQSVSPGAFLMDSTHSSKLSPRSWYHLLMVRSQDV… |
| A0A2H3CSK4 | 12-473 | None |
| A0A2H3CBH2 | 3-401 | None |
| A0A2H3CB70 | 1-335 | None |
| A0A2H3C5A5 | 108-510 | None |
| A0A0D0CUD3 | 216-691 | None |
| A0A2H3EGL9 | 24-426 | None |
| A0A2H3E1Q0 | 1-432 | None |
| A0A2H3CM34 | 42-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.