DPCstruct | MC43310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 86 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6JQY7 | 26-96 | FTVSSPNVIYTDDEIRSKYSYRTTSVVQTATGNFVATPKDTVYDFKVDRKIPKTGMMLVGWGGNNGTTVTA |
| A0A1R3KAL9 | 1-76 | MFIESFKVESPNVKYTDNEIQSVYNYETTELVHENRNGTYQWVVKPKTVKYEFKTDIHVPKLGVLLVGWGGNNGAT |
| W9IV97 | 33-109 | None |
| G5B070 | 7-97 | None |
| F4PXY4 | 6-84 | None |
| A0A2W1BT39 | 4-84 | None |
| A0A3P6CJ92 | 4-74 | None |
| A0A0A1TH78 | 26-103 | None |
| A0A5B0QRM6 | 82-180 | None |
| A0A2N0RR97 | 14-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.