DPCstruct | MC43305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 225 ± 41 aa |
| Standard deviation of domain lengths | 41.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04951 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5Z7J0 | 2-235 | KIYLCTDMEGASGVTMRSEIEPNKERYEFGRRMLTRDVAAAVEGLKAGGATRIVVLDGHGGGDNFLYDELPAGAEYICGRGGDPIPF… |
| A0A532UD12 | 82-329 | LKVYISVDIEGIGGVVSRMQTSGEEYQRFRRFMTQEVNAAIEGAFACGATEVMVSDSHGSGQNILIEELNKEVKLIRDWPRPLIMME… |
| A0A535S2F1 | 2-245 | None |
| A0A4Q3KF93 | 1-248 | None |
| A0A265QDY8 | 3-214 | None |
| A0A6B0DHP8 | 1-253 | None |
| A0A7V5Z0G7 | 60-306 | None |
| A0A1Q7UG93 | 1-242 | None |
| T0EEV6 | 1-203 | None |
| A0A1F9MTY0 | 212-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.