DPCstruct | MC43302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 4.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519ECF8 | 65-126 | SLSVQEMAHLAESLLGIESLKERVTSPSESVGGPIDVAAITKDEGLVWIRRKHYFDAAMNMR |
| A0A136KUR5 | 147-217 | VLSLLAPAQYPVPFAVMPLQDAIEYAYYMINVTIGRYRFVIGPELCGGPIEIAAITPNGFNWISRKSWKLV |
| A0A529M0H6 | 158-218 | None |
| A0A2W5BV11 | 53-113 | None |
| A0A511MKF7 | 124-197 | None |
| A0A2W6SKI1 | 56-114 | None |
| A0A1X0E1X2 | 1-65 | None |
| A0A419DH12 | 24-93 | None |
| A0A0M1W6W5 | 171-231 | None |
| A0A518BRP5 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.