DPCstruct | MC43301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 115 ± 24 aa |
| Standard deviation of domain lengths | 24.27 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 92.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0F9P3 | 26-118 | VSNRHVHITQEDFKTLFGHSYAMRKLKDLMQPGEFASKELLEISGPRGSIKKVRILGPFRKYTQVEISRTDCFKLGIAAPVRESGKI… |
| A0A378BSM4 | 4-101 | RPIPIGISSRHIHLAAADYARLFPAQPIQPKKALLQPGQYAAEQTVTLVGPKGRLNNVRLLGPLRQTSQVEISRTDARILGIAAPLR… |
| A0A0F2IYR3 | 346-446 | None |
| A0A848A8L1 | 301-382 | None |
| A0A661Q5N5 | 247-384 | None |
| A0A2D7QPR1 | 31-191 | None |
| A0A7V3EMV4 | 573-669 | None |
| A0A358PYQ0 | 199-295 | None |
| A0A1F5EET2 | 5-90 | None |
| A0A330LQL4 | 479-594 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.