DPCstruct | MC4330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 128 ± 24 aa |
| Standard deviation of domain lengths | 23.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812HTX6 | 669-766 | GGSCTNANDMKVWKHGGRKSFDASLNHCGRSCAAGYPCTKDCMQKKGYSAGCAGCMAQLVGCSRDHCMNQCITNDKAPACTHCVKSS… |
| A0A7J6LZI5 | 4-120 | FANFLMTLLVVVDGTCNEAEKEKITGKLFPNFLYKCSLAAKLDTSSIAPCLEGPCQISSECANCFNDFGACASKNCGILCFAAGTLS… |
| A0A2M8B724 | 160-292 | None |
| A0A2P9D221 | 129-257 | None |
| A0A0G4HVZ9 | 11-139 | None |
| A0A7S2AEV7 | 3-101 | None |
| A0A078KH46 | 200-323 | None |
| F0X642 | 174-333 | None |
| A0A7J6LG85 | 3-91 | None |
| A0A7J6LG97 | 598-800 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.