DPCstruct | MC433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 125 ± 16 aa |
| Standard deviation of domain lengths | 16.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521L5G5 | 17-145 | APKWTTVVAAPLLYAMIVPLIFVDISLEFYHRLAFPILGIPTVSRGSYIKLDRHLLPYLPFILKLACIYCGYANGLVQYAARIAGDT… |
| A0A1F6MBD6 | 11-131 | PKHLLSLLFIYPPLVPMIFLDLFLEVYHRICFPLYGYPYVKRSAYIRIDRHKLSYLRWWQKLNCMYCGYANGLVHYATVIAGETERY… |
| A0A356RCE9 | 20-147 | None |
| A0A315AW09 | 18-141 | None |
| A0A0D6AP58 | 15-187 | None |
| A0A5C5Z3M9 | 127-250 | None |
| E1YMJ4 | 33-163 | None |
| A0A7V1FVD2 | 4-121 | None |
| A0A1W9IY62 | 67-190 | None |
| A0A1Y6CWS2 | 23-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.