DPCstruct | MC43299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 90 ± 4 aa |
| Standard deviation of domain lengths | 3.76 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7X528 | 219-301 | MQRNWIGKSRGVEMDFPVDGSDLKIKIFTTRPDTLFGATFVCVAPIHPIADIIMDDKNALNDVKSFYGNEEEKRGVFTGKYVV |
| A0A378BL10 | 1-94 | MQRNWIGRSEGVEISFDVNDYADKLTVYTTRPDTFMGCTYLAVAAGHPLAQQAAANNPALATFIDECRNTKVAEADMATMEKKGVDT… |
| A0A378DIG6 | 71-161 | None |
| A0A3S4ZWG1 | 57-145 | None |
| A0A2B4R2S6 | 475-566 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.