DPCstruct | MC43298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 43 ± 3 aa |
| Standard deviation of domain lengths | 2.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.85 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 65.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822FFD8 | 1-38 | MTFDPTKHSHCRYNPLKDEWILVSPQRLSRPWQGQVEG |
| A0A378BJ59 | 1-44 | MSVFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQT |
| A0A6I4KMW7 | 1-44 | None |
| Q2NUK4 | 1-45 | None |
| A0A1X0X3L6 | 1-44 | None |
| A0A7J7INK1 | 52-93 | None |
| A0A6G3HP89 | 1-45 | None |
| A0A395IF16 | 6-45 | None |
| C4Y258 | 1-43 | None |
| A0A0G0H9M6 | 3-39 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.