DPCstruct | MC43292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 188 ± 31 aa |
| Standard deviation of domain lengths | 30.92 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09481 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378A3U9 | 1-180 | MENRFNLIDEPWIAVVDVGLVSLTDIFSQPELRALGGNPVEKIALTKLLLAIAQAAATPTDDSDWQQMGWQGMAHCCLQYLAKWHDR… |
| A0A0A0V1A5 | 2-186 | LEHSFNLVTEPWIPVLADGKHESYSLETLFDQPTSIRQLDIADPLERVSIMRLLLAIMYGAHQDGYSSPAAAKRIMEAGRDQEIIDY… |
| A0A7C3XKU8 | 12-173 | None |
| A0A7H9EIV5 | 67-235 | None |
| D9X6P4 | 2-216 | None |
| A0A2U2NC38 | 55-226 | None |
| A0A3G2JKR5 | 1-247 | None |
| A0A6F9XJA4 | 3-236 | None |
| A0A5N8VC33 | 53-211 | None |
| A0A5C5B9H5 | 180-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.