DPCstruct | MC43290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 96.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378A1G3 | 1-69 | MKGDVKIISYLNKLLGNELVAINQYFLHARMFKNWGLMRLNDIEYHESIDEMKHADKYIERILFLEGIP |
| B0VQ47 | 2-56 | LYHHLTAINQYFLHSRMFNDWGIEQLGSAEYKESIRQMKHADKIIERILFLEGLP |
| A0A3M6R694 | 1-96 | None |
| A0A3M2YK50 | 31-112 | None |
| A0A238L2B0 | 1-83 | None |
| A0A0N8SA78 | 31-112 | None |
| D4DU62 | 1-83 | None |
| A0A855HRS5 | 1-76 | None |
| A0A855HTT6 | 1-73 | None |
| A0A7V8S218 | 31-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.