DPCstruct | MC43288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 95.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377ZYC0 | 1-100 | MLLAVANNDRPAFDKLWQWTDNTLRNKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALLRAQKQWQDKRYAIASDAITAALLKS… |
| R4YG41 | 61-170 | LAVANNDRPAFDKLWQWTDNTLRNKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALLRAQKQWQDKRYAIASDAITAALLKSTV… |
| A0A376JQK6 | 1-105 | None |
| A0A3R7EHW2 | 88-192 | None |
| A0A432VTN2 | 164-299 | None |
| A0A4U9VTJ4 | 1-105 | None |
| A0A2X3CJG2 | 62-166 | None |
| Q44416 | 176-280 | None |
| A0A6D0ELN0 | 36-152 | None |
| A0A7D5KWE9 | 796-912 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.