DPCstruct | MC43287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 11.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376RF10 | 1-132 | MENAKMNSLIAQYPLVKDLVALKETTWFNPGTTSLAEGLPYVGLTEQDVQDAHARLSRFAPYLAKAFPETAATGGIIESELVAIPAM… |
| A0A377ZY34 | 1-132 | MKNADLTTLTATFPLVQDLIALKETTWFNPATTTLAEGLPYVGLTADDVQDAHARLQRFAPYLAAAFPETAASCGIIESEVVAIPAM… |
| R6LNR9 | 5-128 | None |
| A0A1I7YYP4 | 8-139 | None |
| A0A243V023 | 1-132 | None |
| A0A377DP53 | 1-132 | None |
| A0A4U9HFF9 | 1-121 | None |
| A0A433F8J3 | 25-139 | None |
| A0A5M8BRY2 | 229-345 | None |
| A0A380FL47 | 5-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.