DPCstruct | MC43286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 101 ± 16 aa |
| Standard deviation of domain lengths | 16.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K0WE14 | 175-273 | HTDMEETGDFHRSDDMLNQLWSNVRWSTKGNFLSIPTDCPQRDERLGWTGDLALFAPTATFLYGSHGVLNDWLKGLYYEQRKRNGIP… |
| A0A124I0Q9 | 1-106 | MNRLHENVVWSLRGNFVDLPTDCPQRDERLGWTGDIQVFAPTAAFLYDCHGMLGSWLRDVAVEQHDDGTVPWYVPAVPGGPQWTAAL… |
| A0A366PI18 | 465-587 | None |
| A0A416MJE1 | 645-737 | None |
| A0A7W9LYQ3 | 1-99 | None |
| A0A1G7II68 | 713-804 | None |
| A0A100JJB4 | 2-94 | None |
| A0A448ZSL6 | 536-607 | None |
| A0A0K2RJI8 | 186-269 | None |
| A0A2X3F144 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.