DPCstruct | MC43283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 142 ± 19 aa |
| Standard deviation of domain lengths | 18.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R9PMQ4 | 84-203 | PIITISGSCKLGFKTYDKEFNMYQNPFILNDGKKYSIKGYNHANYSGGKILSISPDKKYIVLDYISKGYVDDGINKTLYENYLCVIV… |
| A0A1C0A4R1 | 1-147 | MRYLLYITLLIFSLSCVGTTIKPVPIANKLKITDQIELIFLTYNKEFNLYSDPRLINNEVTSKIEGYYDDEQYTGIDSIDIKISDNK… |
| A0A0G3X3I6 | 1-158 | None |
| A0A1G8DTU9 | 6-130 | None |
| A0A5B7VXQ8 | 2-144 | None |
| A0A1I0RVB5 | 83-205 | None |
| A0A5E4W931 | 21-178 | None |
| A0A5E6Y1B7 | 161-285 | None |
| A0A1H5AUR3 | 112-273 | None |
| A0A1T1BS39 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.