DPCstruct | MC43275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 160 ± 19 aa |
| Standard deviation of domain lengths | 18.75 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0Y4L9 | 16-182 | VQVMIEGPGHVPLNQIAANVLLEKKLCKGAPFYVLGPLVTDIASGYDHIAAAIGGALAAWAGADFLCYVTPAEHLRLPTIEDVREGV… |
| A0A376LGW3 | 58-232 | AAYDVSLSLGDGLRPGSVQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTEELEHCHEAPFYTLGPLTTDIA… |
| D8S5P6 | 267-426 | None |
| A0A7C3XTM9 | 337-517 | None |
| A0A495AAS8 | 229-379 | None |
| A0A847CYT3 | 71-238 | None |
| A0A1B0C474 | 429-599 | None |
| A8FKN8 | 258-423 | None |
| W4QG28 | 32-217 | None |
| A0A4Y6UBA1 | 350-535 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.