DPCstruct | MC43273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 111 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6SHI2 | 86-197 | SLCPCSKEISQYGAHNQRSHVTVSLTADAEVGIEEVIDYVEAQASCQLYGLLKRPDEKYVTEKAYENPKFVEDMVRDVATSLIADKR… |
| A0A7C1HFB0 | 4-112 | RGTLLIGGDWPVRAEHLVHILEASMSSETYELLKRSDEFFIVNKAHQKPMFTEDVVREVFRNLIDIYPDLPDDTFVMVKQENLESIH… |
| A0A7C0U156 | 19-121 | None |
| A0A1V1NU29 | 11-132 | None |
| A0A846ZYC4 | 12-100 | None |
| Q8TZZ2 | 159-266 | None |
| A0A3M6A1S2 | 17-118 | None |
| A0A497AVJ7 | 121-240 | None |
| A0A843H7X9 | 108-224 | None |
| F8XN26 | 6-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.