DPCstruct | MC43272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 151 ± 11 aa |
| Standard deviation of domain lengths | 10.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2WG83 | 1-154 | MTSVDQVKIDGVVLPTTSYRLDDFRVLTRIDGGVWPLCNELNLADTEVGTWSVTATYGATVPTLGQLAVGELMCELVNLLTGNKACS… |
| A0A0B5D9Z5 | 1-150 | MACDRSGSILLPGPVHTILGWVVDGQEMPDGTLNRDGDRVWSRTGTWPQQDLSLPTTEYGTWGIRYQRGLLPPPGADGMVANLAKEI… |
| A0A1S1R637 | 78-228 | None |
| A0A2N6T2A5 | 74-217 | None |
| A0A3N2NXR0 | 1-132 | None |
| A0A5C7LR07 | 90-231 | None |
| A0A5C7LKM9 | 91-255 | None |
| G2PHG2 | 142-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.