DPCstruct | MC43266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 188 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I2FRB8 | 166-352 | LRQLARHPDNNMPPQAEIEYLPHFDNKPILSQGSENLGHMLQAAGTDPRSFYYFQEGMDPILVVPDGNMLIVNPIEDEKRKLRDILK… |
| A0A0F7SD81 | 2-177 | PDPISTDHLPHWRGIPVLTANDDTLGHMLYASKQPNEAFWHYRQDHTPVLVTPKLDNLVSEADLREKNRLNNLLTSYGAARIKYSSS… |
| A0A317XQZ6 | 69-246 | None |
| A0A077QTQ8 | 247-411 | None |
| A0A5C3FSD0 | 113-280 | None |
| A0A5C3FRA0 | 83-293 | None |
| A0A081CHA8 | 428-623 | None |
| A0A081CF28 | 447-611 | None |
| I2FUC2 | 4-178 | None |
| A0A317XN44 | 268-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.