DPCstruct | MC43265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2YG67 | 86-183 | LGYYEWWICHQYIAFTEVLGHSGLRIYGMPPSTLAWLLKGVGMELVIEDHDLHHRKGYRKSHNYGKQTRVWDTLFGTCHERIEAKNQ… |
| A0A0F7S8S6 | 1-100 | MSFFDWMICWTHVMFIEVIGHSGLRITGTAPAFDLFPMKRFDVDLVIEDHDNHHSRGWKKSGNYGKQTRVWDRLFGTVLPRIETLDH… |
| A0A5N6KN58 | 284-382 | None |
| A0A094F6F7 | 620-716 | None |
| A0A816ECS7 | 1-82 | None |
| A0A5N6KXL8 | 97-198 | None |
| A0A2N6NUU4 | 32-131 | None |
| A0A166IKH8 | 705-783 | None |
| A0A7S8HWK3 | 730-829 | None |
| G7EA31 | 925-999 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.