DPCstruct | MC43264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 489 ± 83 aa |
| Standard deviation of domain lengths | 82.83 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF07217- CL0106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F7RZ24 | 220-697 | FGAGNIPSFAYMEGKAFRHGDIEDILEELFKKAGGSLFGSSKFGGLDIKRTYFGNWLRDYSQAMDVAALQKMSKQAILNLVMVLGFL… |
| A0A2S6C5N3 | 22-379 | KKFSKLDVSRLYFGNWLRDYSQAVDVESVRFVSAEAVVLVVWILEFMSFGYGTGEFEVTKERLGVYIPAEHVDNPRGYADGQDARQY… |
| A0A845PD17 | 6-337 | None |
| A0A0G2ZZ00 | 332-781 | None |
| A0A7D8V2F2 | 25-551 | None |
| R8BQX7 | 4-485 | None |
| G4TBQ4 | 24-579 | None |
| X8JL81 | 438-983 | None |
| A0A1Z5T2B5 | 6-614 | None |
| A0A420HUW0 | 41-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.