DPCstruct | MC43263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 146 ± 17 aa |
| Standard deviation of domain lengths | 17.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3XE75 | 29-190 | GFYEHSFEIWLACTVVFPGAGNLGFTLLEYRIGHRDLLASFLENITWVPFFFFFFGGLPIHLSQALLAHLFSYNITWGATKKEVERS… |
| A0A0F7RWX6 | 9-164 | PFEIWVSVNVVFAAGGNVAQILARYRAKADTLFNLVKEHLTWIPYLLIFFGGLSFHVLTALLSHPFGINMTWGATLKDLEDSNFFIE… |
| A0A3L6MQS0 | 34-191 | None |
| A0A163FIR5 | 991-1147 | None |
| A0A4V4IHJ7 | 53-197 | None |
| A0A4U0VAT1 | 68-217 | None |
| A0A0E9NQB9 | 781-936 | None |
| A0A2P7ZUM8 | 957-1104 | None |
| A0A395J675 | 555-662 | None |
| A0A0G4MKN0 | 875-1016 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.