DPCstruct | MC4326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 148 ± 22 aa |
| Standard deviation of domain lengths | 22.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 60.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816GVA4 | 1-136 | IEKQTKDSSQLTATTTETVNKHGDRIITTTTTNYETSTFASKTEWRIRAISATNLHLRTNHIYVSSDDIKETGYRYILPKNILKKFI… |
| A0A1J3IKA9 | 23-146 | GATITVQTTNDQNQRITTTTTTNYEQAQFKSHTDWRLRALSATNMLMRTNNVWTNSEDIKESGFTYIMPKNLLKRFVCISDLKIQIF… |
| C4YMR9 | 394-548 | None |
| A0A251RYI1 | 102-251 | None |
| A0A815YZY3 | 368-505 | None |
| A0A0B1SWK9 | 293-442 | None |
| A0A2U1MHH5 | 31-168 | None |
| A0A0S7F0G9 | 658-808 | None |
| A0A0P0WT59 | 34-183 | None |
| A0A7S1HJ85 | 626-775 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.