DPCstruct | MC43259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 177 ± 18 aa |
| Standard deviation of domain lengths | 17.71 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 93.46 |
| Assigned Pfam label(s) | CL0123- CL0475- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811MS42 | 16-194 | TVPAWLRGLPRAPEYRPTESEFADPIAFLSRVEREAAVYGICKVIPPYPRPSRRFVFAHLNRSLVSSSEAAANPTTASFSSTTGPSL… |
| A0A024USM4 | 104-253 | GYEEMAPVAPARVFYPSVEEFANPIAYLNYVAKEGARYGIAKIVPPKGWAPPHMIHYDNNTNVFETKLQKVHRLREGKSYRDGKDHT… |
| A0A0E0R2X0 | 90-271 | None |
| A0A4S4DIR6 | 29-179 | None |
| A0A6P6G9R4 | 1-198 | None |
| A0A672UY39 | 62-210 | None |
| A0A811MXG0 | 93-252 | None |
| A0A0D2MX51 | 26-205 | None |
| A0A446IRS8 | 71-242 | None |
| A0A1Q3DBP2 | 48-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.