DPCstruct | MC4325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 61.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388L0J0 | 175-249 | EGGKYERILPCCGCGIGWTLFLLGFLVPVLWYVGGFLYLIFPGGLDRRERPGLAATAVAALVNLVFALIAFLILW |
| A0A1J3IEH4 | 47-115 | YDKPLPCFGCGIGWFSFLLGFVCPLLWYYATFLYFGNYYRRDPRERAGLAASAITAMGFSLVLLVILAL |
| A0A6P6T0E1 | 68-151 | None |
| A0A5J5PM88 | 1-72 | None |
| A0A1S3ZEN6 | 17-102 | None |
| A0A0L9UYP5 | 23-106 | None |
| A0A4Y1RV39 | 134-206 | None |
| A0A2P6RYD6 | 30-101 | None |
| A0A1Y1I6A4 | 36-104 | None |
| A0A7J6HWV1 | 30-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.