DPCstruct | MC43247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 143 ± 25 aa |
| Standard deviation of domain lengths | 24.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14996 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3UKA0 | 2-77 | RCLECDHDVATFSGYKWKKSTDYMFLRNNYPNFSKLRCNLAICKSSRAFCCQCNWTDVKQPTRLDPRQFNWVCTKH |
| A0A654HGT2 | 1-128 | MNSDKNINNVALHVDDIEDIITLLECSSLLIGGCEYSPGLTCNGINRSCDRLRCLGCDHEVLIFDGKEWTKSTDYLFLRNNYPDTVS… |
| A0A5B7D822 | 1-98 | None |
| A0A7N4NNN6 | 280-445 | None |
| A0A7V8YEE6 | 1-125 | None |
| A0A226EV88 | 55-209 | None |
| A0A0P4W960 | 18-172 | None |
| D8LN08 | 156-300 | None |
| A0A482S4K2 | 208-384 | None |
| S4RSL1 | 4-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.