DPCstruct | MC43245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 532 |
|---|---|
| Mean domain length (aa) | 116 ± 20 aa |
| Standard deviation of domain lengths | 20.46 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.46 |
| Pfam Score | 95.30 |
| Assigned Pfam label(s) | PF01684- CL0012- CL0117- CL0192- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654HC80 | 29-144 | SLFCILVGLSCAAALECYECSQVAGNTGPCTSTRRTCRVSQDACISFVQYRTPDFWTILSERRPFISKGCTSKMECASQVDFFRDRC… |
| A0A8B6H4T1 | 1-102 | ISCHLCRGPKFICERSYASAVCPDPSQQFCINDVENLKDGSRYVTRRCATKAECDKDWITESSYRNECSHYNVVILQDAHFECSFCC… |
| A0A6P8IDF1 | 65-209 | None |
| A0A2G8LMI6 | 4-170 | None |
| A0A803JA50 | 62-169 | None |
| A0A803JS12 | 202-316 | None |
| A0A2D0QHL7 | 6-146 | None |
| A0A7M5UEL9 | 4-99 | None |
| A0A7M5V7E0 | 7-158 | None |
| A0A067RM99 | 6-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.