DPCstruct | MC43244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 312 ± 52 aa |
| Standard deviation of domain lengths | 52.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF19306- PF08494 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D3XMQ8 | 52-380 | GTIVSSTMVKVKFQKGKFLGQVEEYFISKLTPGDAFWFAGNCLELVRFKGMEATVRLSKQKKGQVPSYMGGRMPLSAELGYFLREKL… |
| A0A6G2G0W2 | 5-266 | DGGPPGVRTWLREFPLDENSVRAVTRMFDEQVRYAGPESVATDSRLVIEEQLDREEYQRRFYVHSNYGRQFNDGLSRLLAHHCAQRS… |
| A0A5P8WBC9 | 2-258 | None |
| A0A2W5ZK57 | 359-721 | None |
| A0A3N9XKU1 | 466-772 | None |
| A0A7W0YL75 | 297-654 | None |
| A0A1E3GYJ3 | 1-315 | None |
| A0A524RNY8 | 2-203 | None |
| A0A4R2K6L7 | 54-354 | None |
| K0EQG7 | 529-874 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.