DPCstruct | MC4324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 357 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517LBL2 | 80-420 | EGSFSRPSQPSEPLQDRPSRESKPLQYRLRQNTNVYLEDRSFIDGFTFLTNVVAAGTSLTRPSPAFTPSTSVLALCATLVVHPTYTT… |
| A0A0D2AYA3 | 1-366 | MGDTSAPTPSTMSVVSNKSRDTHREAKAMPYRLRQAVAVYLENKQFLEGFTLLNSILATGRSAPSAPPVYVPPTSYFELAATLVVHP… |
| A0A139H4Q3 | 402-775 | None |
| A0A6S6UP21 | 176-540 | None |
| A0A0G4LUD0 | 34-400 | None |
| A0A3M7MJD8 | 220-587 | None |
| A0A2S7Q9K9 | 1-367 | None |
| A0A1B8GJ94 | 7-320 | None |
| A0A177D0E4 | 1-366 | None |
| A0A6H0XM33 | 1-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.