DPCstruct | MC43234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 449 ± 64 aa |
| Standard deviation of domain lengths | 63.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 20.43 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | PF17238- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453NAD5 | 10-442 | VQDIDTATVNERELLFVLHLDGSLRVWDISSQTKLVNYNVHLDDFEGQPSRLWVGEADDDQELISLAVLHQGTMVPACDHIGVYAFS… |
| A0A2V1AVS5 | 1-375 | MYDIESHRPLKQIYLSEKYNGINESTTLLHGYVNSVGTTSTTPRLVFVLASFPSSQVKGIGRDALSIMALDFPDDSDIIYNEKYSFE… |
| A0A1D6H0E6 | 248-672 | None |
| A0A453NA87 | 203-659 | None |
| A0A2G8K1E2 | 131-504 | None |
| A0A2R7W7H4 | 116-643 | None |
| A0A2A2KSX6 | 217-646 | None |
| I0YZK2 | 84-650 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.