DPCstruct | MC43233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 213 ± 19 aa |
| Standard deviation of domain lengths | 19.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3YEV8 | 1-192 | MFLKFIYFFIACFLVACSDDSQQITLKNTLPLPKAVHVDYAADIKPIIEEKCVACHGCFDAPCQLKMESTAGLLRGATKLNAYDGTR… |
| A0A378PVW8 | 2-214 | YAGLNYDQLFGEASVQSRQSPVDSKEASFFLSDVKPIIDQRCVVCHACYDAPCQLKMSSVEGIDRGASKALVYHGTRLTASAPTRLF… |
| A0A2D9W1X7 | 9-238 | None |
| A0A3A0C1Y4 | 234-453 | None |
| A0A558HUQ4 | 26-245 | None |
| A0A656GYS9 | 3-177 | None |
| A0A0P9IZJ8 | 1-213 | None |
| A0A2H6G429 | 33-276 | None |
| A0A090TRX2 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.