DPCstruct | MC4323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 240 ± 21 aa |
| Standard deviation of domain lengths | 20.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.49 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0018- PF08601 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8X854 | 116-363 | SYISNDLSPHHVNNNHLASPGTSETSANYDIDKKVLSEQVNGNKRKSKRQLLDEEDAVLIARDDSELTEEELQLKRKAQNRAAQRAF… |
| A0A0D2ALZ2 | 2-229 | STTADMNPSTAPMSVICNVDSRFSTDGVEFPQTDANKAGPHSERRSSSEEKDGLTPAQNRRKAQNRAAQRAFRERKEKHVKDLEARL… |
| A0A7C8KXZ9 | 29-292 | None |
| A0A0F8A1P4 | 419-660 | None |
| A0A421J4B3 | 96-341 | None |
| A0A1X2HET3 | 1-277 | None |
| E9DR54 | 1-202 | None |
| A0A0D9NP66 | 165-405 | None |
| A0A1B7SLR6 | 26-245 | None |
| G0WHY7 | 101-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.