DPCstruct | MC43222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 9.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4HIC6 | 53-156 | VFTTQLNSIPGSAVCAFNMEDIEKVFKGRFKEQKTPDSVWTAVPEDKVPRPRPGCCAKHGPAEAYKTSIDFPDETLSFIKSHPLMDS… |
| A0A8B6DUF0 | 375-466 | YGVFITTTGTPASAICAFNLSSIDAALEGSFKEQTSANTFWTEVTTVPTPRPGQCTNDSMSLSESVLQFIADHPLMHKTVQPMYEKP… |
| A0A4W5MVF2 | 6-106 | None |
| A0A1S3PW25 | 1-86 | None |
| A0A1A9WXA1 | 38-115 | None |
| A0A673KVU2 | 217-318 | None |
| A0A2A3EPW6 | 264-341 | None |
| A0A8B6CR39 | 171-262 | None |
| A0A132A6C9 | 65-144 | None |
| A0A6H5IKD0 | 68-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.