DPCstruct | MC4322
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 174 ± 25 aa |
| Standard deviation of domain lengths | 24.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 69.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3A908 | 1-168 | MAAPPLPQTPVNKSQADNGNAASPPKGPQSPASQSREEQRINLLFEINVELLQEVNRLQAEGKGGAISPQQVAQLKAQGQPAVQASE… |
| A0A0D2AG84 | 1-220 | MAAMSNPMQPTPGGGGAGPLPAHAAMNPASAAAAAAAASAHSNPDLDKQRVALILDINSHLLETIQALQASGKGGDVQSQSNASAPG… |
| B6QAL5 | 205-356 | None |
| A0A6A6YHV2 | 2-153 | None |
| A0A0N1HQT1 | 118-262 | None |
| A0A6G1I2L8 | 275-441 | None |
| A0A0G2HLI1 | 16-165 | None |
| Q2TYB0 | 5-175 | None |
| A0A135TGG0 | 70-282 | None |
| A0A6A6THX0 | 166-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.