DPCstruct | MC43214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 224 ± 38 aa |
| Standard deviation of domain lengths | 37.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353WWT4 | 167-397 | FSFDVLAGYAAGVSAVEIGGLVNIDRMFVKGFQLAGLGNIEGGKVEGVQIAGLWNNNRGRLKGVQLSGVGNVVRDEFKGVQVSGIHN… |
| A0A1G1AEP1 | 6-245 | AGLVICLLSTVLCRGQAVQTVPLQVSLLDPVQLFSDEADVIGLRLNLLYGCNRNVSGIDVGLCSDVKKSFAGIGLSGLLNSSGEAAG… |
| A0A661NQ69 | 169-362 | None |
| A0A1M6T761 | 41-175 | None |
| A0A7X7ZJ47 | 2-221 | None |
| A0A524K2P4 | 34-297 | None |
| A0A388Q6Z8 | 134-290 | None |
| A0A1W9VPQ1 | 372-578 | None |
| A0A7C8DHY0 | 88-331 | None |
| A0A6N9C470 | 48-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.