DPCstruct | MC43211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2IES0 | 23-113 | TALNFQIGANTGQSIAVTIATATTAALTINGISVGSHTLANQAIASIDEAIRAISTSRASLGAIQNRLEHTIANLNVASENLAASES… |
| A0A839K545 | 115-208 | GGSTPVNLNQISLQIGANSNQSLQFQLYDISTGILGLDTVTVIDHLSASNGIHAYDEALNRISGVRSAYGAVQNRLEHAIANAENTA… |
| A0A2E4DVS0 | 79-179 | None |
| A0A5N7Y1W1 | 185-276 | None |
| A0A2A2IGG9 | 79-179 | None |
| A0A3B0C3R7 | 1-91 | None |
| A0A6N8F7M4 | 27-123 | None |
| A0A7C9N1Z6 | 30-134 | None |
| A0A7X4ZLA9 | 345-436 | None |
| A0A7X9BJ55 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.