DPCstruct | MC43209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 198 ± 40 aa |
| Standard deviation of domain lengths | 39.76 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3AAM6 | 49-238 | RRRAAARWILELLEATARRPPQFACFGLHEWAMVFEATERRHARYPLRLPASEIEALVRRLPVCCTHFDAYRFFTASAQPLNQYRLT… |
| A0A847EPQ2 | 23-195 | ERPAQWSCFGLHEWAMVYRTDATRHAWPLRLGADGTDAVVEAHQLRCTHFDAFRFFTPDAVGRNLHAPTRERQVELEQPGCLHASMD… |
| A0A2S8BP93 | 1-131 | None |
| A0A239B452 | 71-313 | None |
| R1BH19 | 98-349 | None |
| D8LQE5 | 179-419 | None |
| A0A7S1GMQ5 | 29-222 | None |
| W7TRZ0 | 9-187 | None |
| A0A6M1R848 | 3-126 | None |
| A0A1E7F8E2 | 306-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.