DPCstruct | MC43205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 295 ± 41 aa |
| Standard deviation of domain lengths | 41.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V2UVJ2 | 328-626 | LAAALRDLVVGEPDEEDLLAVYPLYARTTLPDEPWILLDAALRAGTVEIRDEKRSRHVKARNGGDRPLLILAGELLSGGHQDRVVAH… |
| A0A2E8GZ61 | 16-300 | LTIGPPLYDPTANLPNMVVYPLFPTRPLPAEPPHVITLSQGLRRGVRLSDTGVVSQVHVDNPLSTTILVGESDILVGPTQLRSVQFS… |
| A0A1V5FN69 | 195-498 | None |
| A0A7W1L0C9 | 1-272 | None |
| A0A7Y5RQP3 | 46-303 | None |
| A0A6N8ZVP9 | 233-529 | None |
| A0A662VHD5 | 8-312 | None |
| K9RSH1 | 8-230 | None |
| A0A800LU76 | 130-426 | None |
| A0A7C4ISP1 | 63-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.