DPCstruct | MC43203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 363 |
|---|---|
| Mean domain length (aa) | 248 ± 65 aa |
| Standard deviation of domain lengths | 65.08 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 90.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.00 |
| Pfam Score | 82.70 |
| Assigned Pfam label(s) | PF02769- CL0302- PF00586- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8ZJV7 | 20-244 | TDFINLLYKGIKERVDEFSVALIGGNTSSSPEKVVITSVVLGEAPKEQVVFRKGAMVGDLIFVTGRLGDSSLGLKMWKEKGDSVITD… |
| A0A3S4FKK0 | 276-620 | DALNRADITIADAVNRVLHLPTVAEKTFLVTIGDRTVTGMVARDQMVGPWQVPVADCAVTTASLDSYYGEAMSIGERAPVALLDFAA… |
| A0A4R2EMW5 | 370-608 | None |
| A0A7H1MXA4 | 205-490 | None |
| A0A146H7V5 | 166-440 | None |
| A0A7C2M7M5 | 1-163 | None |
| A0A1Q7UHY3 | 13-210 | None |
| A0A834T600 | 139-322 | None |
| A0A0S4JLG7 | 104-413 | None |
| A0A1V4V9I3 | 18-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.