DPCstruct | MC43201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 622 ± 94 aa |
| Standard deviation of domain lengths | 94.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.39 |
| Pfam Score | 80.14 |
| Assigned Pfam label(s) | CL0123- PF11831 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4E430 | 1-555 | MDEDEKEMLSEARARLANTRGKKAKRKAREAQLDEARRLASLQKKRELKAAGIYASRLGATRRGGKFMDYDKEVPFQKLAPAGFYDV… |
| A0A835NJZ5 | 10-744 | VMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQ… |
| A0A0P0W8V6 | 2-546 | None |
| A0A0C9WJD0 | 2-630 | None |
| A0A232FIW9 | 542-1250 | None |
| A0A423VTG0 | 53-765 | None |
| A0A7J9H1E7 | 36-647 | None |
| A0A0E9NIB4 | 479-1106 | None |
| U6LHZ4 | 60-703 | None |
| A0A5B6VVC4 | 7-798 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.