DPCstruct | MC4320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 144 ± 20 aa |
| Standard deviation of domain lengths | 19.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V8UCT8 | 4-117 | PPKVPIAETNPVPASVQDQITLALLANGGIPRIQAAFRQRLDEAGWSENLRNYVTALFRSGECTTFFEAMEKVKERVGLEGRDGFEG… |
| A0A0D2AB08 | 6-130 | KLHDTLSTALLEAHSIPAIEKVLAQSLAEAGWTTELRAYIQRLVRSGECTNYQQILKKVMAAVTTGKEGSANGAVQNGEGDAAAANA… |
| A0A165K3P7 | 33-191 | None |
| A0A1L9RRZ6 | 1-139 | None |
| A0A6A7BAQ1 | 1-152 | None |
| A0A2P7Z408 | 2-131 | None |
| A0A066XKE1 | 1-168 | None |
| A0A842ZFY5 | 8-119 | None |
| A0A517LNM8 | 8-148 | None |
| A0A6A6WNQ6 | 2-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.