DPCstruct | MC432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A6JSF4 | 28-88 | AAKPDFSFEKCFGVVKAGLNDCQTASHSCAGTATADNAKDSWIYIPAGTCSKITGGSTEPK |
| A0A521K002 | 2-59 | PELPSGWEACGGVAKAGMNDCAVKTSLHACVGMAKKDGEPDSYVFLPKGLCAKISNGA |
| A0A2I1DNR5 | 72-145 | None |
| A0A3M4RKR9 | 47-124 | None |
| A0A1Y5SSL3 | 2-68 | None |
| A0A7W6Z7I9 | 170-232 | None |
| A0A6N8V8Q9 | 1-55 | None |
| A0A482ZV16 | 3-64 | None |
| A0A1M3GXX6 | 3-84 | None |
| A0A6N7B693 | 12-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.