DPCstruct | MC43196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 376 ± 61 aa |
| Standard deviation of domain lengths | 61.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.37 |
| Pfam Score | 84.32 |
| Assigned Pfam label(s) | PF08295- PF16879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S8VSI8 | 1-405 | MDFSSCARHTPSYRALPMSLAQPRSHRRLSLELAVLNDMCINVSSEKACGFMHPKKDKCEQELFQLEDQRYELDMIIDANSACVAVL… |
| T0LBL6 | 15-301 | EASLVIERLDFLITSLEIVYSNLGTDELSIKDIGMSPGIIKEVLKNIYDESASEILEGILINPKKAIPILIKRLYAVNKDLREKLRQ… |
| M4CWY0 | 75-392 | None |
| A0A6J3CBY4 | 18-490 | None |
| A0A811MYK2 | 545-861 | None |
| A0A7N0REP5 | 465-818 | None |
| A0A0C2MR01 | 202-589 | None |
| A0A0K0EKT0 | 1039-1467 | None |
| Q6FNH7 | 264-684 | None |
| A0A5D3DIK1 | 444-781 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.