DPCstruct | MC43192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 3.01 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821CWN9 | 4-73 | LAQRKNDPRQGHHRPQLIEPLKTWDFFRGDVVEVMVGKDKGKQGNIAAYIRELNAVFVSGLNLVNIKNFS |
| A0A061I6H5 | 1-71 | MSRPGSLSDKRKNPPWSRWRPVVIEPISDEDWHLFCGDMVEILQGKDAGKQGKVVQVIRQQNWVVLEGLNT |
| A0A1B6C5X9 | 65-133 | None |
| A0A7R8X7Y3 | 622-691 | None |
| A0A6I9XIZ1 | 14-85 | None |
| A0A482RWU8 | 14-80 | None |
| A0A7J7L6D2 | 1-68 | None |
| A0A7J6TPX6 | 11-76 | None |
| A0A4S2JBA6 | 658-733 | None |
| A0A1B0DDW2 | 50-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.