DPCstruct | MC43190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 77 ± 3 aa |
| Standard deviation of domain lengths | 3.03 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 78.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0512 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821ADJ9 | 1-73 | EQFPYKIEHVYIVKPDGFWDKHKISLGMSKYTFEHSVQSLESLTYTIDRNQLTPDLNGTFQYNHIRWLDFRLV |
| A0A0R3Q7U2 | 33-105 | QEHFPAEVYAVLIIKPDKFWEKHKTSVSSGKYKFDIQMISVEGLTRYIDSSQLTRDLGGSLFYDHDEWLETRL |
| A0A183TVH2 | 16-96 | None |
| A0A482X171 | 97-173 | None |
| A0A6P4L1D1 | 1-77 | None |
| A0A3Q3EYJ5 | 19-96 | None |
| A0A7R9K975 | 3-83 | None |
| A0A6I9NZ85 | 17-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.