DPCstruct | MC4319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 59.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1MJ31 | 24-86 | MVTKRRCLQVYDGSKLLCRDEMMMSSAWEVKANLAGGEAEVSDLDYWTVVRANAFHDAAKEAR |
| A0A0D2A784 | 1-88 | MKMKKRVLCVYDGQRRLWKDDMMLDSEFEVRMRLPGGDGKQYITDLDVQTIKRAEAILGATEEERGPWVQNNVYEAPGMPALDSLYQV |
| A0A2C5XVB5 | 692-767 | None |
| A0A1V8UQL7 | 36-108 | None |
| A0A2J6Q8Q6 | 1060-1119 | None |
| A0A093XYT6 | 127-201 | None |
| R8BDJ9 | 187-268 | None |
| A0A0G4MV48 | 786-854 | None |
| A0A4Q4QGU8 | 1-80 | None |
| A0A074W1J0 | 263-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.