DPCstruct | MC43184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 151 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847CQD5 | 505-629 | GGSLFVENNYGYNLLSATNGRSSEPGMTRIDVAEDGSDCETVWENTEIRVPSVVSKGSTTGVIVSYTREDSIWGIDAWYFTALDATT… |
| A0A7K1B136 | 572-722 | QSEQTIIVLGTGAFVVNNLIEEGHPDRIIDVLTVGPVHAPPHGVEKLVWNQREQRFYSGWARGDVVSISMVPLASSGAGAVFVNGYS… |
| A0A284VQH7 | 74-201 | None |
| A0A0L0M261 | 153-317 | None |
| A0A1V5HX72 | 85-237 | None |
| A0A5C5ZAV5 | 391-553 | None |
| A0A2D0N2B6 | 316-462 | None |
| A0A1V5VU24 | 58-186 | None |
| A0A6N7Y930 | 386-531 | None |
| A0A658QUA3 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.