DPCstruct | MC4318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 153 ± 17 aa |
| Standard deviation of domain lengths | 16.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 25.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A093Y650 | 2-140 | GIEYKSDRDKVRASNAEGGWDNYYGNEVETWELVLGAFSTLIPGGVGVAAWTEWQISSQLAKFGQSLGDLPRDLADQAIDLLKKIIQ… |
| A0A0D2A4N0 | 2-147 | TVFSDREQVQQEIAAGGWDILWGDVINEFDALTFLVSLPTGTTAAWVAEQVEVQLQKFAQSSTDVSSDVLHQATLILEGIVEGKWLG… |
| A0A812QSQ5 | 1-168 | None |
| A0A2Z5X3N0 | 1-175 | None |
| A0A5N7DLP0 | 6-127 | None |
| A0A521G123 | 28-181 | None |
| A0A1Q9DMS9 | 114-288 | None |
| A0A0F9X461 | 1-152 | None |
| A0A2I2FHE9 | 5-146 | None |
| A0A5S9ITD4 | 23-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.